PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN38939.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 341aa    MW: 38165.9 Da    PI: 7.2501
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN38939.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.93e-201562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+d++ ++G g+W+t +++ g++R++k+c++rw +yl
       KHN38939.1 15 KGPWTPEEDEKLIDYISKHGHGSWRTLPKRAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding50.16.2e-1668112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++++ ++++ +  lG++ W++Ia++++ gRt++++k++w+++
       KHN38939.1  68 RGKFSEDDERIIINFHSVLGNK-WSKIAAHLP-GRTDNEIKNYWNTH 112
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-26765IPR009057Homeodomain-like
PROSITE profilePS5129426.5821066IPR017930Myb domain
SuperFamilySSF466899.17E-3212109IPR009057Homeodomain-like
SMARTSM007172.2E-161464IPR001005SANT/Myb domain
PfamPF002493.1E-181562IPR001005SANT/Myb domain
CDDcd001676.56E-131762No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2566117IPR009057Homeodomain-like
SMARTSM007171.9E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129421.69467117IPR017930Myb domain
PfamPF002491.5E-1468112IPR001005SANT/Myb domain
CDDcd001671.46E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGRSPCCEES SSVKKGPWTP EEDEKLIDYI SKHGHGSWRT LPKRAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEDDERIII NFHSVLGNKW SKIAAHLPGR TDNEIKNYWN THIRKKLLKM  120
GIDPETHKPR TDLNHLMSLS QLLGMSNLSS AISTAWGNKP LGLQPDITQL AKIQLVQNLL  180
QLINNNSFVN IGNNNPYLLS NPNLNPLFLN GINPLQTNKE PHVVLSGSEE YANPGLYSQA  240
QSQCSQHDVS KSLADLDGGS IPQDYNKINS TTTSRENLAE NPPLPALVAF PPKMGTFNQM  300
DSGCNIAAQT STESPSNTIF DDWEKLLDDE TSGSYWKEIL E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31151177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587596.10.0PREDICTED: transcription factor MYB39-like isoform X2
TrEMBLA0A0B2S3K30.0A0A0B2S3K3_GLYSO; Transcription factor MYB39
STRINGGLYMA09G33870.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-83myb domain protein 9
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]